SCOPe 2.03: Domain d2gmka_: 2gmk A:

Lineage for d2gmka_ (2gmk A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Amphibian cytotoxic ribonuclease [54084] (5 species)

7. Species Frog (Rana pipiens), P-30 [TaxId:8404] [54083] (10 PDB entries)

8. Domain d2gmka_: 2gmk A: [164762]
   automated match to d1onca_
   complexed with amp; mutant

Details for d2gmka_

PDB Entry: 2gmk, 1.65 Å

PDB Description: crystal structure of onconase double mutant with spontaneously- assembled (amp) 4 stack

PDB Compounds: (A:) P-30 protein

SCOPe Domain Sequences for d2gmka_:

Sequence; same for both SEQRES and ATOM records:

>d2gmka_ d.5.1.1 (A:) Amphibian cytotoxic ribonuclease {Frog (Rana pipiens), P-30 [TaxId: 8404]}
edwltfqkkhitntrdvdcdnimstnlfhckdkntfiysrpepvkaickgiiasknvltt
sefylsdcnvtsrpckyklkkstnkfcvncanqapvhfvgvgsc

Timeline for d2gmka_:

• d2gmka_ first appeared in SCOPe 2.01
  
• d2gmka_ appears in SCOPe 2.02
  
• d2gmka_ appears in SCOPe 2.04
  
• d2gmka_ appears in the current release, SCOPe 2.08