Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d2glnb_ (2gln B:)

  1. Root: SCOP 1.75B
  2. Class a: All alpha proteins [46456] (284 folds)
  3. Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. Family a.1.1.1: Truncated hemoglobin [46459] (2 protein domains)
    lack the first helix (A)
  6. Protein Protozoan/bacterial hemoglobin [46460] (6 species)
  7. Species Mycobacterium tuberculosis, HbN [TaxId:1773] [63437] (8 PDB entries)
    Uniprot Q10784
  8. Domain d2glnb_: 2gln B: [164761]
    automated match to d1s56b_
    complexed with cyn, hem, na, po4; mutant

Details for d2glnb_

PDB Entry: 2gln (more details)
PDB Description: crystal structure of mycobacterium tuberculosis trhbn, glne11ala mutant
PDB Compounds: (B:) Hemoglobin-like protein HbN

SCOP Domain Sequences for d2glnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2glnb_ a.1.1.1 (B:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbN [TaxId: 1773]}
gllsrlrkrepisiydkiggheaievvvedfyvrvladdqlsaffsgtnmsrlkgkavef
faaalggpepytgapmkqvhqgrgitmhhfslvaghladaltaagvpsetiteilgviap
lavdvtsgestt

SCOP Domain Coordinates for d2glnb_:

Click to download the PDB-style file with coordinates for d2glnb_.
(The format of our PDB-style files is described here.)

Timeline for d2glnb_:

d2glnb_ appears in SCOP 1.75A


d2glnb_
(click for larger image)


d2glnb_ in context of chain



d2glnb_ in context of PDB
Domains from other chains:
d2glna_

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu