![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily) |
![]() | Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (3 families) ![]() conserved core consists of a helix and a loop crosslinked with two disulfides |
![]() | Family g.68.1.1: Ovomucoid domain III-like [57468] (11 proteins) |
![]() | Protein automated matches [190305] (3 species) not a true protein |
![]() | Species Turkey (Meleagris gallopavo) [TaxId:9103] [187118] (3 PDB entries) |
![]() | Domain d2gkti_: 2gkt I: [164747] automated match to d1omta_ |
PDB Entry: 2gkt (more details), 1.23 Å
SCOPe Domain Sequences for d2gkti_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gkti_ g.68.1.1 (I:) automated matches {Turkey (Meleagris gallopavo) [TaxId: 9103]} vdcseypkpactleyrplcgsdnktyankcnfcnavvesngtltlshfgkc
Timeline for d2gkti_: