Lineage for d2gkoa_ (2gko A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2873305Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2873306Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2873307Family c.41.1.1: Subtilases [52744] (15 proteins)
  6. 2873644Protein automated matches [190073] (16 species)
    not a true protein
  7. 2873702Species Bacillus subtilis [TaxId:1423] [187756] (2 PDB entries)
  8. 2873703Domain d2gkoa_: 2gko A: [164746]
    automated match to d1ea7a_
    complexed with ca, na, pms

Details for d2gkoa_

PDB Entry: 2gko (more details), 1.4 Å

PDB Description: s41 psychrophilic protease
PDB Compounds: (A:) microbial serine proteinases; subtilisin

SCOPe Domain Sequences for d2gkoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gkoa_ c.41.1.1 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
aasqstpwgikaiynnsnltstsggaginiavldtgvntnhpdlsnnveqckdftvgtnf
tdnsctdrqghgthvagsalanggtgsgvygvapeadlwaykvlgddgsgyaddiaeair
hagdqatalntkvvinmslgssgesslitnavdyaydkgvliiaaagnsgpkpgsigypg
alvnavavaalentiqngtyrvadfssrghkrtagdyviqkgdveisapgaavystwfdg
gyatisgtsmasphaaglaakiwaqspaasnvdvrgelqtrasvndilsgnsagsgddia
sgfgfakvq

SCOPe Domain Coordinates for d2gkoa_:

Click to download the PDB-style file with coordinates for d2gkoa_.
(The format of our PDB-style files is described here.)

Timeline for d2gkoa_: