SCOPe 2.07: Domain d2gknb_: 2gkn B:

Lineage for d2gknb_ (2gkn B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins)
   lack the first helix (A)

6. Protein Protozoan/bacterial hemoglobin [46460] (6 species)

7. Species Mycobacterium tuberculosis, HbN [TaxId:1773] [63437] (8 PDB entries)
   Uniprot Q10784

8. Domain d2gknb_: 2gkn B: [164745]
   automated match to d1s56b_
   complexed with cyn, hem, na; mutant

Details for d2gknb_

PDB Entry: 2gkn, 2.1 Å

PDB Description: crystal structure of mycobacterium tuberculosis trhbn, glne11val mutant

PDB Compounds: (B:) Hemoglobin-like protein HbN

SCOPe Domain Sequences for d2gknb_:

Sequence; same for both SEQRES and ATOM records:

>d2gknb_ a.1.1.1 (B:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbN [TaxId: 1773]}
gllsrlrkrepisiydkiggheaievvvedfyvrvladdqlsaffsgtnmsrlkgkvvef
faaalggpepytgapmkqvhqgrgitmhhfslvaghladaltaagvpsetiteilgviap
lavdvt

Timeline for d2gknb_:

• d2gknb_ first appeared in SCOPe 2.01
  
• d2gknb_ appears in SCOPe 2.06
  
• d2gknb_ appears in the current release, SCOPe 2.08