| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins) lack the first helix (A) |
| Protein Protozoan/bacterial hemoglobin [46460] (6 species) |
| Species Mycobacterium tuberculosis, HbN [TaxId:1773] [63437] (8 PDB entries) Uniprot Q10784 |
| Domain d2gkmb_: 2gkm B: [164743] automated match to d1s56b_ complexed with cyn, hem, na; mutant |
PDB Entry: 2gkm (more details), 1.73 Å
SCOPe Domain Sequences for d2gkmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gkmb_ a.1.1.1 (B:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbN [TaxId: 1773]}
gllsrlrkrepisiydkiggheaievvvedffvrvladdqlsaffsgtnmsrlkgkqvef
faaalggpepytgapmkqvhqgrgitmhhfslvaghladaltaagvpsetiteilgviap
lavdvt
Timeline for d2gkmb_: