Lineage for d2gjdb_ (2gjd B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1021591Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1021592Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1021593Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1021601Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 1021604Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187672] (2 PDB entries)
  8. 1021606Domain d2gjdb_: 2gjd B: [164731]
    automated match to d1a3sa_

Details for d2gjdb_

PDB Entry: 2gjd (more details), 1.75 Å

PDB Description: Distinct functional domains of Ubc9 dictate cell survival and resistance to genotoxic stress
PDB Compounds: (B:) Ubiquitin-conjugating enzyme E2-18 kDa

SCOPe Domain Sequences for d2gjdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gjdb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sslclqrlqeerkkwrkdhpfgfyakpvkkadgsmdlqkweagipgkegtnwaggvypit
veypneypskppkvkfpagfyhpnvypsgticlsilnedqdwrpaitlkqivlgvqdlld
spnpnspaqepawrsfsrnkaeydkkvllqakqysk

SCOPe Domain Coordinates for d2gjdb_:

Click to download the PDB-style file with coordinates for d2gjdb_.
(The format of our PDB-style files is described here.)

Timeline for d2gjdb_: