SCOP 1.59: Domain d1f66f

Root: SCOP 1.59
Class a: All alpha proteins [46456] (151 folds)
Fold a.22: Histone-fold [47112] (1 superfamily)
Superfamily a.22.1: Histone-fold [47113] (3 families)
Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
Protein Histone H4 [47125] (4 species)
Species Mouse (Mus musculus) [TaxId:10090] [47128] (1 PDB entry)
Domain d1f66f_: 1f66 F: [16473]
Other proteins in same PDB: d1f66a_, d1f66c_, d1f66d_, d1f66e_, d1f66g_, d1f66h_

PDB Entry: 1f66 (more details), 2.6 Å

PDB Description: 2.6 a crystal structure of a nucleosome core particle containing the variant histone h2a.z

SCOP Domain Sequences for d1f66f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f66f_ a.22.1.1 (F:) Histone H4 {Mouse (Mus musculus)}
rhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtyteha
krktvtamdvvyalkrqgrtlygfgg

SCOP Domain Coordinates for d1f66f_:

Click to download the PDB-style file with coordinates for d1f66f_.
(The format of our PDB-style files is described here.)

Timeline for d1f66f_:

Thumbnails for d1f66f_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1f66a_, d1f66b_, d1f66c_, d1f66d_, d1f66e_, d1f66g_, d1f66h_