SCOPe 2.08: Domain d2gj3b_: 2gj3 B:

Lineage for d2gj3b_ (2gj3 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.0: automated matches [191387] (1 protein)
   not a true family

6. Protein automated matches [190492] (24 species)
   not a true protein

7. Species Azotobacter vinelandii [TaxId:354] [187754] (1 PDB entry)

8. Domain d2gj3b_: 2gj3 B: [164729]
   automated match to d1n9na_
   complexed with eoh, fad, so4

Details for d2gj3b_

PDB Entry: 2gj3, 1.04 Å

PDB Description: crystal structure of the fad-containing pas domain of the protein nifl from azotobacter vinelandii.

PDB Compounds: (B:) Nitrogen fixation regulatory protein

SCOPe Domain Sequences for d2gj3b_:

Sequence; same for both SEQRES and ATOM records:

>d2gj3b_ d.110.3.0 (B:) automated matches {Azotobacter vinelandii [TaxId: 354]}
ellpeifrqtvehapiaisitdlkanilyanrafrtitgygseevlgknesilsngttpr
lvyqalwgrlaqkkpwsgvlvnrrkdktlylaeltvapvlneagetiyylgmhrdtsel

Timeline for d2gj3b_:

• d2gj3b_ first appeared in SCOPe 2.01
  
• d2gj3b_ appears in SCOPe 2.07