Lineage for d2gilc_ (2gil C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867983Protein automated matches [190047] (37 species)
    not a true protein
  7. 2868094Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)
  8. 2868361Domain d2gilc_: 2gil C: [164722]
    automated match to d1yzqa1
    complexed with gtp, mg

Details for d2gilc_

PDB Entry: 2gil (more details), 1.82 Å

PDB Description: structure of the extremely slow gtpase rab6a in the gtp bound form at 1.8 resolution
PDB Compounds: (C:) Ras-related protein Rab-6A

SCOPe Domain Sequences for d2gilc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gilc_ c.37.1.8 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fklvflgeqsvgktslitrfmydsfdntyqatigidflsktmyledrtvrlqlwdtagqe
rfrslipsyirdstvavvvyditnvnsfqqttkwiddvrtergsdviimlvgnktdladk
rqvsieegerkakelnvmfietsakagynvkqlfrrvaaal

SCOPe Domain Coordinates for d2gilc_:

Click to download the PDB-style file with coordinates for d2gilc_.
(The format of our PDB-style files is described here.)

Timeline for d2gilc_: