SCOPe 2.07: Domain d2gila_: 2gil A:

Lineage for d2gila_ (2gil A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (80 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (34 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (286 PDB entries)

8. Domain d2gila_: 2gil A: [164720]
   automated match to d1yzqa1
   complexed with gtp, mg

Details for d2gila_

PDB Entry: 2gil, 1.82 Å

PDB Description: structure of the extremely slow gtpase rab6a in the gtp bound form at 1.8 resolution

PDB Compounds: (A:) Ras-related protein Rab-6A

SCOPe Domain Sequences for d2gila_:

Sequence; same for both SEQRES and ATOM records:

>d2gila_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fklvflgeqsvgktslitrfmydsfdntyqatigidflsktmyledrtvrlqlwdtagqe
rfrslipsyirdstvavvvyditnvnsfqqttkwiddvrtergsdviimlvgnktdladk
rqvsieegerkakelnvmfietsakagynvkqlfrrvaaal

Timeline for d2gila_:

• d2gila_ first appeared in SCOPe 2.01
  
• d2gila_ appears in SCOPe 2.06
  
• d2gila_ appears in the current release, SCOPe 2.08