Lineage for d1f66b_ (1f66 B:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 151058Fold a.22: Histone-fold [47112] (1 superfamily)
  4. 151059Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 151060Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
  6. 151110Protein Histone H4 [47125] (4 species)
  7. 151124Species Mouse (Mus musculus) [TaxId:10090] [47128] (1 PDB entry)
  8. 151125Domain d1f66b_: 1f66 B: [16472]
    Other proteins in same PDB: d1f66a_, d1f66c_, d1f66d_, d1f66e_, d1f66g_, d1f66h_

Details for d1f66b_

PDB Entry: 1f66 (more details), 2.6 Å

PDB Description: 2.6 a crystal structure of a nucleosome core particle containing the variant histone h2a.z

SCOP Domain Sequences for d1f66b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f66b_ a.22.1.1 (B:) Histone H4 {Mouse (Mus musculus)}
rdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvt
amdvvyalkrqgrtlygfgg

SCOP Domain Coordinates for d1f66b_:

Click to download the PDB-style file with coordinates for d1f66b_.
(The format of our PDB-style files is described here.)

Timeline for d1f66b_: