| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
| Protein Histone H4 [47125] (7 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [47128] (1 PDB entry) |
| Domain d1f66b_: 1f66 B: [16472] Other proteins in same PDB: d1f66a_, d1f66c_, d1f66d_, d1f66e_, d1f66g_, d1f66h_ protein/DNA complex; complexed with mn |
PDB Entry: 1f66 (more details), 2.6 Å
SCOPe Domain Sequences for d1f66b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f66b_ a.22.1.1 (B:) Histone H4 {Mouse (Mus musculus) [TaxId: 10090]}
rdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvt
amdvvyalkrqgrtlygfgg
Timeline for d1f66b_: