SCOPe 2.08: Domain d2ghza_: 2ghz A:

Lineage for d2ghza_ (2ghz A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Azurin [49530] (6 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [49533] (96 PDB entries)
   Uniprot P00282

8. Domain d2ghza_: 2ghz A: [164707]
   automated match to d1azna_
   complexed with cu; mutant

Details for d2ghza_

PDB Entry: 2ghz, 1.6 Å

PDB Description: crystal structure of azurin phe114pro mutant

PDB Compounds: (A:) Azurin

SCOPe Domain Sequences for d2ghza_:

Sequence; same for both SEQRES and ATOM records:

>d2ghza_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]}
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctppghsal
mkgtltlk

Timeline for d2ghza_:

• d2ghza_ first appeared in SCOPe 2.01
  
• d2ghza_ appears in SCOPe 2.07