SCOPe 2.08: Domain d2ghtb_: 2ght B:

Lineage for d2ghtb_ (2ght B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.16: NLI interacting factor-like phosphatase [110509] (2 proteins)
   Pfam PF03031; NIF; the insertion subdomain is a 3-stranded beta-sheet;

6. Protein automated matches [190659] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187808] (8 PDB entries)

8. Domain d2ghtb_: 2ght B: [164706]
   automated match to d1ta0a_
   protein/RNA complex; complexed with mg

Details for d2ghtb_

PDB Entry: 2ght, 1.8 Å

PDB Description: ctd-specific phosphatase scp1 in complex with peptide from c-terminal domain of rna polymerase ii

PDB Compounds: (B:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1

SCOPe Domain Sequences for d2ghtb_:

Sequence; same for both SEQRES and ATOM records:

>d2ghtb_ c.108.1.16 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qyllpeakaqdsdkicvvinldetlvhssfkpvnnadfiipveidgvvhqvyvlkrphvd
eflqrmgelfecvlftaslakyadpvadlldkwgafrarlfrescvfhrgnyvkdlsrlg
rdlrrvlildnspasyvfhpdnavpvaswfdnmsdtelhdllpffeqlsrvddvysvlrq

Timeline for d2ghtb_:

• d2ghtb_ first appeared in SCOPe 2.01
  
• d2ghtb_ appears in SCOPe 2.07