Lineage for d2ghex_ (2ghe X:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 919407Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 919408Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 919409Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 919410Protein Ascorbate peroxidase [48123] (3 species)
  7. 919416Species Soybean (Glycine max) [TaxId:3847] [89092] (9 PDB entries)
    Uniprot Q43758
  8. 919423Domain d2ghex_: 2ghe X: [164700]
    automated match to d1oafa_
    complexed with hem, na

Details for d2ghex_

PDB Entry: 2ghe (more details), 1.75 Å

PDB Description: conformational mobility in the active site of a heme peroxidase
PDB Compounds: (X:) cytosolic ascorbate peroxidase 1

SCOPe Domain Sequences for d2ghex_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ghex_ a.93.1.1 (X:) Ascorbate peroxidase {Soybean (Glycine max) [TaxId: 3847]}
sgksyptvsadyqkavekakkklrgfiaekrcaplmlrlaahsagtfdkgtktggpfgti
khpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgre
dkpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwt
snplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahq
klselgfada

SCOPe Domain Coordinates for d2ghex_:

Click to download the PDB-style file with coordinates for d2ghex_.
(The format of our PDB-style files is described here.)

Timeline for d2ghex_: