Class a: All alpha proteins [46456] (284 folds) |
Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) |
Family a.93.1.1: CCP-like [48114] (5 proteins) |
Protein Ascorbate peroxidase [48123] (3 species) |
Species Soybean (Glycine max) [TaxId:3847] [89092] (9 PDB entries) Uniprot Q43758 |
Domain d2ghex_: 2ghe X: [164700] automated match to d1oafa_ complexed with hem, na |
PDB Entry: 2ghe (more details), 1.75 Å
SCOPe Domain Sequences for d2ghex_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ghex_ a.93.1.1 (X:) Ascorbate peroxidase {Soybean (Glycine max) [TaxId: 3847]} sgksyptvsadyqkavekakkklrgfiaekrcaplmlrlaahsagtfdkgtktggpfgti khpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgre dkpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwt snplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahq klselgfada
Timeline for d2ghex_: