SCOPe 2.08: Domain d2ghex1: 2ghe X:2-250

Lineage for d2ghex1 (2ghe X:2-250)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.1: CCP-like [48114] (5 proteins)

6. Protein Ascorbate peroxidase [48123] (3 species)

7. Species Soybean (Glycine max) [TaxId:3847] [89092] (15 PDB entries)
   Uniprot Q43758

8. Domain d2ghex1: 2ghe X:2-250 [164700]
   Other proteins in same PDB: d2ghex2
   automated match to d1oafa_
   complexed with hem, na

Details for d2ghex1

PDB Entry: 2ghe, 1.75 Å

PDB Description: conformational mobility in the active site of a heme peroxidase

PDB Compounds: (X:) cytosolic ascorbate peroxidase 1

SCOPe Domain Sequences for d2ghex1:

Sequence; same for both SEQRES and ATOM records:

>d2ghex1 a.93.1.1 (X:2-250) Ascorbate peroxidase {Soybean (Glycine max) [TaxId: 3847]}
gksyptvsadyqkavekakkklrgfiaekrcaplmlrlaahsagtfdkgtktggpfgtik
hpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgred
kpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwts
nplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahqk
lselgfada

Timeline for d2ghex1:

• d2ghex1 first appeared in SCOPe 2.01, called d2ghex_
  
• d2ghex1 appears in SCOPe 2.07