Lineage for d1aoib_ (1aoi B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311419Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2311420Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2311421Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2311791Protein Histone H4 [47125] (7 species)
  7. 2311792Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (67 PDB entries)
  8. 2311853Domain d1aoib_: 1aoi B: [16470]
    Other proteins in same PDB: d1aoia_, d1aoic_, d1aoid_, d1aoie_, d1aoig_, d1aoih_
    protein/DNA complex; complexed with mn

Details for d1aoib_

PDB Entry: 1aoi (more details), 2.8 Å

PDB Description: complex between nucleosome core particle (h3,h4,h2a,h2b) and 146 bp long dna fragment
PDB Compounds: (B:) histone h4

SCOPe Domain Sequences for d1aoib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aoib_ a.22.1.1 (B:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
kvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrk
tvtamdvvyalkrqgrtlygfgg

SCOPe Domain Coordinates for d1aoib_:

Click to download the PDB-style file with coordinates for d1aoib_.
(The format of our PDB-style files is described here.)

Timeline for d1aoib_: