SCOPe 2.05: Domain d2ghdx_: 2ghd X:

Lineage for d2ghdx_ (2ghd X:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.1: CCP-like [48114] (5 proteins)

6. Protein Ascorbate peroxidase [48123] (3 species)

7. Species Soybean (Glycine max) [TaxId:3847] [89092] (9 PDB entries)
   Uniprot Q43758

8. Domain d2ghdx_: 2ghd X: [164699]
   automated match to d1oafa_
   complexed with cyn, hem, so4

Details for d2ghdx_

PDB Entry: 2ghd, 1.4 Å

PDB Description: conformational mobility in the active site of a heme peroxidase

PDB Compounds: (X:) cytosolic ascorbate peroxidase 1

SCOPe Domain Sequences for d2ghdx_:

Sequence; same for both SEQRES and ATOM records:

>d2ghdx_ a.93.1.1 (X:) Ascorbate peroxidase {Soybean (Glycine max) [TaxId: 3847]}
sgksyptvsadyqkavekakkklrgfiaekrcaplmlrlaahsagtfdkgtktggpfgti
khpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgre
dkpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwt
snplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahq
klselgfad

Timeline for d2ghdx_:

• d2ghdx_ first appeared in SCOPe 2.01
  
• d2ghdx_ appears in SCOPe 2.04
  
• d2ghdx_ is called d2ghdx1 in SCOPe 2.06
  
• d2ghdx_ appears in the current release, SCOPe 2.08, called d2ghdx1