![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) multihelical; consists of two all-alpha domains |
![]() | Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) ![]() |
![]() | Family a.93.1.1: CCP-like [48114] (5 proteins) |
![]() | Protein Ascorbate peroxidase [48123] (3 species) |
![]() | Species Soybean (Glycine max) [TaxId:3847] [89092] (15 PDB entries) Uniprot Q43758 |
![]() | Domain d2ghdx1: 2ghd X:2-249 [164699] Other proteins in same PDB: d2ghdx2 automated match to d1oafa_ complexed with cyn, hem, so4 |
PDB Entry: 2ghd (more details), 1.4 Å
SCOPe Domain Sequences for d2ghdx1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ghdx1 a.93.1.1 (X:2-249) Ascorbate peroxidase {Soybean (Glycine max) [TaxId: 3847]} gksyptvsadyqkavekakkklrgfiaekrcaplmlrlaahsagtfdkgtktggpfgtik hpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgred kpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwts nplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahqk lselgfad
Timeline for d2ghdx1: