Lineage for d2ghcx1 (2ghc X:2-249)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719957Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2719958Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2719959Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2719960Protein Ascorbate peroxidase [48123] (3 species)
  7. 2719966Species Soybean (Glycine max) [TaxId:3847] [89092] (15 PDB entries)
    Uniprot Q43758
  8. 2719967Domain d2ghcx1: 2ghc X:2-249 [164698]
    Other proteins in same PDB: d2ghcx2
    automated match to d1oafa_
    complexed with hem, na, no

Details for d2ghcx1

PDB Entry: 2ghc (more details), 1.25 Å

PDB Description: conformational mobility in the active site of a heme peroxidase
PDB Compounds: (X:) cytosolic ascorbate peroxidase 1

SCOPe Domain Sequences for d2ghcx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ghcx1 a.93.1.1 (X:2-249) Ascorbate peroxidase {Soybean (Glycine max) [TaxId: 3847]}
gksyptvsadyqkavekakkklrgfiaekrcaplmlrlaahsagtfdkgtktggpfgtik
hpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgred
kpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwts
nplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahqk
lselgfad

SCOPe Domain Coordinates for d2ghcx1:

Click to download the PDB-style file with coordinates for d2ghcx1.
(The format of our PDB-style files is described here.)

Timeline for d2ghcx1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ghcx2