Lineage for d2gh4a_ (2gh4 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330024Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2330025Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2330193Family a.102.1.6: Hypothetical protein YteR [89108] (2 protein domains)
    unknown function; weak sequence similarity to the catalytic domain of cellulases
    automatically mapped to Pfam PF07470
  6. 2330194Protein Hypothetical protein YteR [89109] (1 species)
  7. 2330195Species Bacillus subtilis [TaxId:1423] [89110] (2 PDB entries)
  8. 2330196Domain d2gh4a_: 2gh4 A: [164692]
    automated match to d1nc5a_

Details for d2gh4a_

PDB Entry: 2gh4 (more details), 1.9 Å

PDB Description: YteR/D143N/dGalA-Rha
PDB Compounds: (A:) Putative glycosyl hydrolase yteR

SCOPe Domain Sequences for d2gh4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gh4a_ a.102.1.6 (A:) Hypothetical protein YteR {Bacillus subtilis [TaxId: 1423]}
kspltyaealantimntytveelppanrwhyhqgvflcgvlrlweatgekryfeyakaya
dlliddngnllfrrdeldaiqaglilfplyeqtkderyvkaakrlrslygtlnrtseggf
whkdgypyqmwlnglymggpfalkyanlkqetelfdqvvlqeslmrkhtkdaktglfyha
wdeakkmpwaneetgcspefwarsigwyvmsladmieelpkkhpnrhvwkntlqdmiksi
cryqdketglwyqivdkgdrsdnwlessgsclymyaiakginkgyldrayettllkayqg
liqhktetsedgaflvkdicvgtsagfydyyvsrerstndlhgagafilamteleplfrs
agk

SCOPe Domain Coordinates for d2gh4a_:

Click to download the PDB-style file with coordinates for d2gh4a_.
(The format of our PDB-style files is described here.)

Timeline for d2gh4a_: