SCOPe 2.01: Domain d2gh0c_: 2gh0 C:

Lineage for d2gh0c_ (2gh0 C:)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.0: automated matches [191392] (1 protein)
   not a true family

6. Protein automated matches [190506] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187459] (12 PDB entries)

8. Domain d2gh0c_: 2gh0 C: [164690]
   automated match to d1agqa_
   complexed with nag

Details for d2gh0c_

PDB Entry: 2gh0, 1.92 Å

PDB Description: growth factor/receptor complex

PDB Compounds: (C:) artemin

SCOPe Domain Sequences for d2gh0c_:

Sequence; same for both SEQRES and ATOM records:

>d2gh0c_ g.17.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpgcrlrsqlvpvralglghrsdelvrfrfcsgscrrarsphdlslasllgagalrpppg
srpvsqpccrptryeavsfmdvnstwrtvdrlsatacgcl

Timeline for d2gh0c_:

• d2gh0c_ is new in SCOPe 2.01-stable
  
• d2gh0c_ appears in SCOPe 2.02
  
• d2gh0c_ appears in the current release, SCOPe 2.08, called d2gh0c1