SCOPe 2.04: Domain d1hiod_: 1hio D:

Lineage for d1hiod_ (1hio D:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H4 [47125] (7 species)

7. Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47126] (6 PDB entries)
   Uniprot P62801

8. Domain d1hiod_: 1hio D: [16469]
   Other proteins in same PDB: d1hioa_, d1hiob_, d1hioc_

Details for d1hiod_

PDB Entry: 1hio, 3.1 Å

PDB Description: histone octamer (chicken), chromosomal protein, alpha carbons only

PDB Compounds: (D:) histone h4

SCOPe Domain Sequences for d1hiod_:

Sequence; same for both SEQRES and ATOM records:

>d1hiod_ a.22.1.1 (D:) Histone H4 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]}
qgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvtamdv
vyalkrqgrtlygfgg

Timeline for d1hiod_:

• d1hiod_ first appeared (with stable ids) in SCOP 1.55
  
• d1hiod_ appears in SCOPe 2.03
  
• d1hiod_ appears in SCOPe 2.05
  
• d1hiod_ appears in the current release, SCOPe 2.08