Class a: All alpha proteins [46456] (284 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (4 families) |
Family a.22.1.1: Nucleosome core histones [47114] (5 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H4 [47125] (5 species) |
Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47126] (5 PDB entries) Uniprot P62801 |
Domain d1hiod_: 1hio D: [16469] Other proteins in same PDB: d1hioa_, d1hiob_, d1hioc_ |
PDB Entry: 1hio (more details), 3.1 Å
SCOP Domain Sequences for d1hiod_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hiod_ a.22.1.1 (D:) Histone H4 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} qgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvtamdv vyalkrqgrtlygfgg
Timeline for d1hiod_: