SCOPe 2.01: Domain d2ggvb_: 2ggv B:

Lineage for d2ggvb_ (2ggv B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.3: Viral proteases [50596] (5 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein automated matches [190658] (2 species)
   not a true protein

7. Species West Nile virus [TaxId:11082] [187751] (2 PDB entries)

8. Domain d2ggvb_: 2ggv B: [164689]
   automated match to d2ijob1
   mutant

Details for d2ggvb_

PDB Entry: 2ggv, 1.8 Å

PDB Description: crystal structure of the west nile virus ns2b-ns3 protease, his51ala mutant

PDB Compounds: (B:) non-structural protein 3

SCOPe Domain Sequences for d2ggvb_:

Sequence; same for both SEQRES and ATOM records:

>d2ggvb_ b.47.1.3 (B:) automated matches {West Nile virus [TaxId: 11082]}
pkeykkgdtttgvyrimtrgllgsyqagagvmvegvfhtlwattkgaalmsgegrldpyw
gsvkedrlcyggpwqlqhkwngqdevqmivvepgrnvknvqtkpgvfktpegeigavtld
fptgtsgspivdkngdviglygngvimpngsyisaivqgermdepipag

Timeline for d2ggvb_:

• d2ggvb_ is new in SCOPe 2.01-stable
  
• d2ggvb_ appears in SCOPe 2.02
  
• d2ggvb_ appears in the current release, SCOPe 2.08