Lineage for d2gfta_ (2gft A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2831217Protein automated matches [190057] (28 species)
    not a true protein
  7. 2831234Species Bacillus licheniformis [TaxId:1402] [187025] (3 PDB entries)
  8. 2831236Domain d2gfta_: 2gft A: [164682]
    automated match to d1ur0b_
    complexed with ca; mutant

Details for d2gfta_

PDB Entry: 2gft (more details), 2.3 Å

PDB Description: crystal structure of the e263a nucleophile mutant of bacillus licheniformis endo-beta-1,4-galactanase in complex with galactotriose
PDB Compounds: (A:) Glycosyl Hydrolase Family 53

SCOPe Domain Sequences for d2gfta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gfta_ c.1.8.3 (A:) automated matches {Bacillus licheniformis [TaxId: 1402]}
glyvekvsglrkdfikgvdvssiialeesgvafynesgkkqdifktlkeagvnyvrvriw
ndpydangngygggnndlekaiqigkratangmklladfhysdfwadpakqkapkawanl
nfedkktalyqytkqslkamkaagidigmvqvgnetngglagetdwakmsqlfnagsqav
retdsnilvalhftnpetsgryawiaetlhrhhvdydvfassyypfwhgtlknltsvlts
vadtygkkvmvaatsytytaedgdghgntapkngqtlnnpvtvqgqanavrdviqavsdv
geagigvfywepawipvgpahrleknkalwetygsgwatsyaaeydpedagkwfggsavd
nqalfdfkgrplpslhvfqyvdtgtp

SCOPe Domain Coordinates for d2gfta_:

Click to download the PDB-style file with coordinates for d2gfta_.
(The format of our PDB-style files is described here.)

Timeline for d2gfta_: