Lineage for d2hiod_ (2hio D:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1482597Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1482598Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1482599Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1482912Protein Histone H4 [47125] (7 species)
  7. 1482993Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47126] (6 PDB entries)
    Uniprot P62801
  8. 1483002Domain d2hiod_: 2hio D: [16468]
    Other proteins in same PDB: d2hioa_, d2hiob_, d2hioc_

Details for d2hiod_

PDB Entry: 2hio (more details), 3.1 Å

PDB Description: histone octamer (chicken), chromosomal protein
PDB Compounds: (D:) protein (histone h4)

SCOPe Domain Sequences for d2hiod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hiod_ a.22.1.1 (D:) Histone H4 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]}
niqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvtam
dvvyalkrqertlygfgg

SCOPe Domain Coordinates for d2hiod_:

Click to download the PDB-style file with coordinates for d2hiod_.
(The format of our PDB-style files is described here.)

Timeline for d2hiod_: