Class a: All alpha proteins [46456] (171 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (3 families) |
Family a.22.1.1: Nucleosome core histones [47114] (4 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H4 [47125] (4 species) |
Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47126] (4 PDB entries) |
Domain d2hiod_: 2hio D: [16468] Other proteins in same PDB: d2hioa_, d2hiob_, d2hioc_ |
PDB Entry: 2hio (more details), 3.1 Å
SCOP Domain Sequences for d2hiod_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hiod_ a.22.1.1 (D:) Histone H4 {Chicken (Gallus gallus), erythrocytes} niqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvtam dvvyalkrqertlygfgg
Timeline for d2hiod_: