SCOP 1.63: Domain d2hiod_: 2hio D:

Lineage for d2hiod_ (2hio D:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (3 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H4 [47125] (4 species)

7. Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47126] (4 PDB entries)

8. Domain d2hiod_: 2hio D: [16468]
   Other proteins in same PDB: d2hioa_, d2hiob_, d2hioc_

Details for d2hiod_

PDB Entry: 2hio, 3.1 Å

PDB Description: histone octamer (chicken), chromosomal protein

SCOP Domain Sequences for d2hiod_:

Sequence; same for both SEQRES and ATOM records:

>d2hiod_ a.22.1.1 (D:) Histone H4 {Chicken (Gallus gallus), erythrocytes}
niqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvtam
dvvyalkrqertlygfgg

Timeline for d2hiod_:

• d2hiod_ first appeared (with stable ids) in SCOP 1.55
  
• d2hiod_ appears in SCOP 1.61
  
• d2hiod_ appears in SCOP 1.65
  
• d2hiod_ appears in the current release, SCOPe 2.08