Lineage for d1eqzh_ (1eqz H:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 46311Fold a.22: Histone-fold [47112] (1 superfamily)
  4. 46312Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 46313Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
  6. 46354Protein Histone H4 [47125] (3 species)
  7. 46358Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47126] (4 PDB entries)
  8. 46362Domain d1eqzh_: 1eqz H: [16467]
    Other proteins in same PDB: d1eqza_, d1eqzb_, d1eqzc_, d1eqze_, d1eqzf_, d1eqzg_

Details for d1eqzh_

PDB Entry: 1eqz (more details), 2.5 Å

PDB Description: x-ray structure of the nucleosome core particle at 2.5 a resolution

SCOP Domain Sequences for d1eqzh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eqzh_ a.22.1.1 (H:) Histone H4 {Chicken (Gallus gallus), erythrocytes}
kglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvir
davtytehakrktvtamdvvyalkrqgrtlygfgg

SCOP Domain Coordinates for d1eqzh_:

Click to download the PDB-style file with coordinates for d1eqzh_.
(The format of our PDB-style files is described here.)

Timeline for d1eqzh_: