Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins) |
Protein automated matches [190074] (15 species) not a true protein |
Species Thermoanaerobacter tengcongensis [TaxId:119072] [187747] (1 PDB entry) |
Domain d2geba1: 2geb A:1-180 [164669] Other proteins in same PDB: d2geba2 automated match to d1r3ua_ complexed with ca; mutant |
PDB Entry: 2geb (more details), 1.7 Å
SCOPe Domain Sequences for d2geba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2geba1 c.61.1.1 (A:1-180) automated matches {Thermoanaerobacter tengcongensis [TaxId: 119072]} mpspmedieeiliteeqlkakvkelgemitrdyegkdlvligvlkgaimfmsglsraidl plsidflavssygsstkssgivkiikdhdidiegkdvlivediidsgltlaylretllgr kprslkictildkperreadvkvdycgfkipdkfvvgygidyaekyrnlpfigvlkpely
Timeline for d2geba1: