Lineage for d2gdfd_ (2gdf D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2778276Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2778888Protein automated matches [190035] (28 species)
    not a true protein
  7. 2779036Species Dioclea violacea [TaxId:192415] [187744] (2 PDB entries)
  8. 2779040Domain d2gdfd_: 2gdf D: [164668]
    automated match to d1dgla_
    complexed with ca, mn

Details for d2gdfd_

PDB Entry: 2gdf (more details), 2.4 Å

PDB Description: Crystal structure of Dioclea violacea seed lectin
PDB Compounds: (D:) lectin

SCOPe Domain Sequences for d2gdfd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gdfd_ b.29.1.1 (D:) automated matches {Dioclea violacea [TaxId: 192415]}
adtivaveldsypntdigdpnyphigidiksirskstarwnmqtgkvgtvhisynsvakr
lsavvsysgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktnsa
adenslhfsfhkfsqnpkdlilqgdaftdsdgnleltkvsssgdpqgnsvgralfyapvh
iweksavvasfdatftflikspdrepadgitffiantdtsipsgsggrllglfpdan

SCOPe Domain Coordinates for d2gdfd_:

Click to download the PDB-style file with coordinates for d2gdfd_.
(The format of our PDB-style files is described here.)

Timeline for d2gdfd_: