Class b: All beta proteins [48724] (178 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.1: Legume lectins [49900] (5 proteins) |
Protein automated matches [190035] (28 species) not a true protein |
Species Dioclea violacea [TaxId:192415] [187744] (2 PDB entries) |
Domain d2gdfc_: 2gdf C: [164667] automated match to d1dgla_ complexed with ca, mn |
PDB Entry: 2gdf (more details), 2.4 Å
SCOPe Domain Sequences for d2gdfc_:
Sequence, based on SEQRES records: (download)
>d2gdfc_ b.29.1.1 (C:) automated matches {Dioclea violacea [TaxId: 192415]} adtivaveldsypntdigdpnyphigidiksirskstarwnmqtgkvgtvhisynsvakr lsavvsysgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktnsa adenslhfsfhkfsqnpkdlilqgdaftdsdgnleltkvsssgdpqgnsvgralfyapvh iweksavvasfdatftflikspdrepadgitffiantdtsipsgsggrllglfpdan
>d2gdfc_ b.29.1.1 (C:) automated matches {Dioclea violacea [TaxId: 192415]} adtivaveldsypntdigdpnyphigidiksirskstarwnmqtgkvgtvhisynsvakr lsavvsysgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktens lhfsfhkfsqnpkdlilqgdaftdsdgnleltkvqgnsvgralfyapvhiweksavvasf datftflikspdrepadgitffiantdtsipsgsggrllglfpdan
Timeline for d2gdfc_: