Lineage for d2gdfc_ (2gdf C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2042198Family b.29.1.1: Legume lectins [49900] (5 protein domains)
  6. 2042739Protein automated matches [190035] (27 species)
    not a true protein
  7. 2042869Species Dioclea violacea [TaxId:192415] [187744] (2 PDB entries)
  8. 2042872Domain d2gdfc_: 2gdf C: [164667]
    automated match to d1dgla_
    complexed with ca, mn

Details for d2gdfc_

PDB Entry: 2gdf (more details), 2.4 Å

PDB Description: Crystal structure of Dioclea violacea seed lectin
PDB Compounds: (C:) lectin

SCOPe Domain Sequences for d2gdfc_:

Sequence, based on SEQRES records: (download)

>d2gdfc_ b.29.1.1 (C:) automated matches {Dioclea violacea [TaxId: 192415]}
adtivaveldsypntdigdpnyphigidiksirskstarwnmqtgkvgtvhisynsvakr
lsavvsysgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktnsa
adenslhfsfhkfsqnpkdlilqgdaftdsdgnleltkvsssgdpqgnsvgralfyapvh
iweksavvasfdatftflikspdrepadgitffiantdtsipsgsggrllglfpdan

Sequence, based on observed residues (ATOM records): (download)

>d2gdfc_ b.29.1.1 (C:) automated matches {Dioclea violacea [TaxId: 192415]}
adtivaveldsypntdigdpnyphigidiksirskstarwnmqtgkvgtvhisynsvakr
lsavvsysgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktens
lhfsfhkfsqnpkdlilqgdaftdsdgnleltkvqgnsvgralfyapvhiweksavvasf
datftflikspdrepadgitffiantdtsipsgsggrllglfpdan

SCOPe Domain Coordinates for d2gdfc_:

Click to download the PDB-style file with coordinates for d2gdfc_.
(The format of our PDB-style files is described here.)

Timeline for d2gdfc_: