SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2gdfb_ (2gdf B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2042198Family b.29.1.1: Legume lectins [49900] (5 protein domains)
  6. 2042739Protein automated matches [190035] (23 species)
    not a true protein
  7. 2042869Species Dioclea violacea [TaxId:192415] [187744] (2 PDB entries)
  8. 2042871Domain d2gdfb_: 2gdf B: [164666]
    automated match to d1dgla_
    complexed with ca, mn

Details for d2gdfb_

PDB Entry: 2gdf (more details), 2.4 Å

PDB Description: Crystal structure of Dioclea violacea seed lectin
PDB Compounds: (B:) lectin

SCOPe Domain Sequences for d2gdfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gdfb_ b.29.1.1 (B:) automated matches {Dioclea violacea [TaxId: 192415]}
adtivaveldsypntdigdpnyphigidiksirskstarwnmqtgkvgtvhisynsvakr
lsavvsysgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktnsa
adenslhfsfhkfsqnpkdlilqgdaftdsdgnleltkvsssgdpqgnsvgralfyapvh
iweksavvasfdatftflikspdrepadgitffiantdtsipsgsggrllglfpdan

SCOPe Domain Coordinates for d2gdfb_:

Click to download the PDB-style file with coordinates for d2gdfb_.
(The format of our PDB-style files is described here.)

Timeline for d2gdfb_: