SCOPe 2.06: Domain d2gbza_: 2gbz A:

Lineage for d2gbza_ (2gbz A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (35 species)
   not a true protein

7. Species Xanthomonas campestris pv. campestris [TaxId:340] [187742] (1 PDB entry)

8. Domain d2gbza_: 2gbz A: [164664]
   automated match to d1ytaa1
   complexed with mg

Details for d2gbza_

PDB Entry: 2gbz, 2.3 Å

PDB Description: the crystal structure of xc847 from xanthomonas campestris: a 3-5 oligoribonuclease of dnaq fold family with a novel opposingly-shifted helix

PDB Compounds: (A:) Oligoribonuclease

SCOPe Domain Sequences for d2gbza_:

Sequence; same for both SEQRES and ATOM records:

>d2gbza_ c.55.3.0 (A:) automated matches {Xanthomonas campestris pv. campestris [TaxId: 340]}
ndrliwidlemtgldtdrdsiieiativtdaqlnvlaegpelaiahsletleamdewnrn
qhrrsglwqrvldsqvthaqaeaqtvaflgewiragaspmcgnsicqdrrflhrqmsrle
ryfhyrnldvstikelarrwapavasgfakssahtalsdvrdsidelrhyrqfmgtlgg

Timeline for d2gbza_:

• d2gbza_ first appeared in SCOPe 2.01
  
• d2gbza_ appears in SCOPe 2.05
  
• d2gbza_ appears in SCOPe 2.07
  
• d2gbza_ appears in the current release, SCOPe 2.08