Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) consists of one domain of this fold |
Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
Protein automated matches [190396] (35 species) not a true protein |
Species Xanthomonas campestris pv. campestris [TaxId:340] [187742] (1 PDB entry) |
Domain d2gbza_: 2gbz A: [164664] automated match to d1ytaa1 complexed with mg |
PDB Entry: 2gbz (more details), 2.3 Å
SCOPe Domain Sequences for d2gbza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gbza_ c.55.3.0 (A:) automated matches {Xanthomonas campestris pv. campestris [TaxId: 340]} ndrliwidlemtgldtdrdsiieiativtdaqlnvlaegpelaiahsletleamdewnrn qhrrsglwqrvldsqvthaqaeaqtvaflgewiragaspmcgnsicqdrrflhrqmsrle ryfhyrnldvstikelarrwapavasgfakssahtalsdvrdsidelrhyrqfmgtlgg
Timeline for d2gbza_: