Lineage for d1hq3d_ (1hq3 D:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1482597Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1482598Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1482599Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1482912Protein Histone H4 [47125] (7 species)
  7. 1482993Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47126] (6 PDB entries)
    Uniprot P62801
  8. 1482998Domain d1hq3d_: 1hq3 D: [16464]
    Other proteins in same PDB: d1hq3a_, d1hq3b_, d1hq3c_, d1hq3e_, d1hq3f_, d1hq3g_
    complexed with cl, po4

Details for d1hq3d_

PDB Entry: 1hq3 (more details), 2.15 Å

PDB Description: crystal structure of the histone-core-octamer in kcl/phosphate
PDB Compounds: (D:) histone h4-vi

SCOPe Domain Sequences for d1hq3d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hq3d_ a.22.1.1 (D:) Histone H4 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]}
kvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrk
tvtamdvvyalkrqgrtlygfgg

SCOPe Domain Coordinates for d1hq3d_:

Click to download the PDB-style file with coordinates for d1hq3d_.
(The format of our PDB-style files is described here.)

Timeline for d1hq3d_: