Lineage for d2gbrc_ (2gbr C:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1402145Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1402146Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1402659Protein automated matches [190118] (8 species)
    not a true protein
  7. 1402675Species Human (Homo sapiens) [TaxId:9606] [189560] (36 PDB entries)
  8. 1402706Domain d2gbrc_: 2gbr C: [164639]
    automated match to d1aara_
    complexed with cd; mutant

Details for d2gbrc_

PDB Entry: 2gbr (more details), 2 Å

PDB Description: crystal structure of the 35-36 moad insertion mutant of ubiquitin
PDB Compounds: (C:) Ubiquitin

SCOPe Domain Sequences for d2gbrc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gbrc_ d.15.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqifvktltgktitlevepsdtienvkakiqdkegrwalaippdqqrlifagkqledgrt
lsdyniqkestlhlvl

SCOPe Domain Coordinates for d2gbrc_:

Click to download the PDB-style file with coordinates for d2gbrc_.
(The format of our PDB-style files is described here.)

Timeline for d2gbrc_: