Lineage for d2gbrb_ (2gbr B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2932413Protein automated matches [190118] (16 species)
    not a true protein
  7. 2932448Species Human (Homo sapiens) [TaxId:9606] [189560] (113 PDB entries)
  8. 2932542Domain d2gbrb_: 2gbr B: [164638]
    automated match to d1aara_
    complexed with cd; mutant

Details for d2gbrb_

PDB Entry: 2gbr (more details), 2 Å

PDB Description: crystal structure of the 35-36 moad insertion mutant of ubiquitin
PDB Compounds: (B:) Ubiquitin

SCOPe Domain Sequences for d2gbrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gbrb_ d.15.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqifvktltgktitlevepsdtienvkakiqdkegrwalaippdqqrlifagkqledgrt
lsdyniqkestlhlvlr

SCOPe Domain Coordinates for d2gbrb_:

Click to download the PDB-style file with coordinates for d2gbrb_.
(The format of our PDB-style files is described here.)

Timeline for d2gbrb_: