SCOPe 2.02: Domain d2gbja_: 2gbj A:

Lineage for d2gbja_ (2gbj A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein automated matches [190118] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189560] (37 PDB entries)

8. Domain d2gbja_: 2gbj A: [164626]
   automated match to d1aara_
   mutant

Details for d2gbja_

PDB Entry: 2gbj, 1.35 Å

PDB Description: Crystal Structure of the 9-10 8 Glycine Insertion Mutant of Ubiquitin.

PDB Compounds: (A:) Ubiquitin

SCOPe Domain Sequences for d2gbja_:

Sequence; same for both SEQRES and ATOM records:

>d2gbja_ d.15.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqifvktltgggggggggktitlevepsdtienvkakiqdkegippdqqrlifagkqled
grtlsdyniqkestlhlvlrl

Timeline for d2gbja_:

• d2gbja_ first appeared in SCOPe 2.01
  
• d2gbja_ appears in SCOPe 2.03
  
• d2gbja_ appears in the current release, SCOPe 2.08