SCOPe 2.07: Domain d2g9aa1: 2g9a A:29-333

Lineage for d2g9aa1 (2g9a A:29-333)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.4: WD40 repeat-like [50978] (4 families)
   also contains 8-bladed propellers

5. Family b.69.4.0: automated matches [191412] (1 protein)
   not a true family

6. Protein automated matches [190568] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187559] (91 PDB entries)

8. Domain d2g9aa1: 2g9a A:29-333 [164609]
   Other proteins in same PDB: d2g9aa2
   automated match to d1vyhc1
   protein/DNA complex

Details for d2g9aa1

PDB Entry: 2g9a, 2.7 Å

PDB Description: Structural basis for the specific recognition of methylated histone H3 lysine 4 by the WD-40 protein WDR5

PDB Compounds: (A:) wd-repeat protein 5

SCOPe Domain Sequences for d2g9aa1:

Sequence; same for both SEQRES and ATOM records:

>d2g9aa1 b.69.4.0 (A:29-333) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tpvkpnyalkftlaghtkavssvkfspngewlasssadklikiwgaydgkfektisghkl
gisdvawssdsnllvsasddktlkiwdvssgkclktlkghsnyvfccnfnpqsnlivsgs
fdesvriwdvktgkclktlpahsdpvsavhfnrdgslivsssydglcriwdtasgqclkt
lidddnppvsfvkfspngkyilaatldntlklwdyskgkclktytghknekycifanfsv
tggkwivsgsednlvyiwnlqtkeivqklqghtdvvistachpteniiasaalendktik
lwksd

Timeline for d2g9aa1:

• d2g9aa1 first appeared in SCOPe 2.01, called d2g9aa_
  
• d2g9aa1 appears in SCOPe 2.06
  
• d2g9aa1 appears in the current release, SCOPe 2.08