Class b: All beta proteins [48724] (178 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.4: WD40 repeat-like [50978] (4 families) also contains 8-bladed propellers |
Family b.69.4.0: automated matches [191412] (1 protein) not a true family |
Protein automated matches [190568] (9 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187559] (91 PDB entries) |
Domain d2g9aa1: 2g9a A:29-333 [164609] Other proteins in same PDB: d2g9aa2 automated match to d1vyhc1 protein/DNA complex |
PDB Entry: 2g9a (more details), 2.7 Å
SCOPe Domain Sequences for d2g9aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g9aa1 b.69.4.0 (A:29-333) automated matches {Human (Homo sapiens) [TaxId: 9606]} tpvkpnyalkftlaghtkavssvkfspngewlasssadklikiwgaydgkfektisghkl gisdvawssdsnllvsasddktlkiwdvssgkclktlkghsnyvfccnfnpqsnlivsgs fdesvriwdvktgkclktlpahsdpvsavhfnrdgslivsssydglcriwdtasgqclkt lidddnppvsfvkfspngkyilaatldntlklwdyskgkclktytghknekycifanfsv tggkwivsgsednlvyiwnlqtkeivqklqghtdvvistachpteniiasaalendktik lwksd
Timeline for d2g9aa1: