Lineage for d2g8xb_ (2g8x B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212073Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2212074Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2212075Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2212113Protein Thymidylate synthase [55833] (7 species)
  7. 2212128Species Escherichia coli [TaxId:562] [55834] (67 PDB entries)
  8. 2212152Domain d2g8xb_: 2g8x B: [164606]
    automated match to d1an5a_
    complexed with co3, dtt, po4

Details for d2g8xb_

PDB Entry: 2g8x (more details), 1.83 Å

PDB Description: escherichia coli y209w apoprotein
PDB Compounds: (B:) Thymidylate synthase

SCOPe Domain Sequences for d2g8xb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g8xb_ d.117.1.1 (B:) Thymidylate synthase {Escherichia coli [TaxId: 562]}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlwsnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapv

SCOPe Domain Coordinates for d2g8xb_:

Click to download the PDB-style file with coordinates for d2g8xb_.
(The format of our PDB-style files is described here.)

Timeline for d2g8xb_: