SCOPe 2.01: Domain d2g8co_: 2g8c O:

Lineage for d2g8co_ (2g8c O:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.76: open-sided beta-meander [51086] (2 superfamilies)
   single sheet formed by beta-hairpin repeats; exposed on both sides in the middle

4. Superfamily b.76.1: Outer surface protein [51087] (1 family)
   21 stranded sheet partly folded upon itself at the ends

5. Family b.76.1.1: Outer surface protein [51088] (3 proteins)

6. Protein automated matches [190440] (1 species)
   not a true protein

7. Species Lyme disease spirochete (Borrelia burgdorferi) [TaxId:139] [188450] (12 PDB entries)

8. Domain d2g8co_: 2g8c O: [164601]
   automated match to d1fj1e_
   complexed with imd, pg4

Details for d2g8co_

PDB Entry: 2g8c, 1.15 Å

PDB Description: atomic-resolution crystal structure of borrelia burgdorferi ospa via surface entropy reduction

PDB Compounds: (O:) Outer surface protein A

SCOPe Domain Sequences for d2g8co_:

Sequence; same for both SEQRES and ATOM records:

>d2g8co_ b.76.1.1 (O:) automated matches {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]}
nsvsvdlpgsmkvlvskssnadgkydliatvdalelsgtsdknngsgvlegvkadaskvk
ltisddlgqttlevfksdgstlvskkvtskdkssteekfnekgevsekiitradgtrley
tgiksdgsgkakevlkgyvlegtltaekttlvvkegtvtlsknisksgavsvelndtdss
aatkktaawnsgtstltitvnskktkdlvftssntitvqqydsngtslegsaveitklde
iknalk

Timeline for d2g8co_:

• d2g8co_ is new in SCOPe 2.01-stable
  
• d2g8co_ appears in SCOPe 2.02
  
• d2g8co_ appears in the current release, SCOPe 2.08