Lineage for d2g85a_ (2g85 A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1230651Fold d.258: Chorismate synthase, AroC [103262] (1 superfamily)
    duplication: consists of two DCoH-like beta(2)-alpha-beta(2)-alpha structural repeats; 3 layers, beta/alpha/beta
  4. 1230652Superfamily d.258.1: Chorismate synthase, AroC [103263] (2 families) (S)
  5. 1230653Family d.258.1.1: Chorismate synthase, AroC [103264] (2 proteins)
  6. 1230654Protein Chorismate synthase, AroC [103265] (6 species)
  7. 1230677Species Mycobacterium tuberculosis [TaxId:1773] [187738] (1 PDB entry)
  8. 1230678Domain d2g85a_: 2g85 A: [164597]
    automated match to d1q1la_

Details for d2g85a_

PDB Entry: 2g85 (more details), 2.22 Å

PDB Description: Crystal structure of chorismate synthase from Mycobacterium tuberculosis at 2.22 angstrons of resolution
PDB Compounds: (A:) Chorismate synthase

SCOPe Domain Sequences for d2g85a_:

Sequence, based on SEQRES records: (download)

>d2g85a_ d.258.1.1 (A:) Chorismate synthase, AroC {Mycobacterium tuberculosis [TaxId: 1773]}
mlrwitageshgralvavvegmvagvhvtsadiadqlarrrlgygrgarmtferdavtvl
sgirhgstlggpiaieigntewpkwetvmaadpvdpaeladvarnapltrprpghadyag
mlkygfddarpvlerasaretaarvaagtvaraflrqalgvevlshvisigasapyegpp
praedlpaidaspvraydkaaeadmiaqieaakkdgdtlggvveavalglpvglgsftsg
dhrldsqlaaavmgiqaikgveigdgfqtarrrgsrahdemypgpdgvvrstnraggleg
gmtngqplrvraamkpistvpralatvdlatgdeavaihqrsdvcavpaagvvvetmval
vlaraalekfggdslaetqrniaayqrsvadr

Sequence, based on observed residues (ATOM records): (download)

>d2g85a_ d.258.1.1 (A:) Chorismate synthase, AroC {Mycobacterium tuberculosis [TaxId: 1773]}
mlrwitageshgralvavvegmvagvhvtsadiadqlarrrlgygferdavtvlsgirhg
stlggpiaieigntewpkwetvmaadpvdpaeladvarnapltrprpghadyagmlkygf
ddarpvlerasaretaarvaagtvaraflrqalgvevlshvisigasapyegpppraedl
paidaspvraydkaaeadmiaqieaakkdgdtlggvveavalglpvglgsftsgdhrlds
qlaaavmgiqaikgveigdgfqtarrrgsrahdemypgpdgvvrstnraggleggmtngq
plrvraamkpistvpralatvdlatgdeavaihqrsdvcavpaagvvvetmvalvlaraa
lekfggdslaetqrniaayqrsvadr

SCOPe Domain Coordinates for d2g85a_:

Click to download the PDB-style file with coordinates for d2g85a_.
(The format of our PDB-style files is described here.)

Timeline for d2g85a_: