Lineage for d2g7zb1 (2g7z B:1-279)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921751Fold c.119: DAK1/DegV-like [82548] (1 superfamily)
    2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest]
  4. 2921752Superfamily c.119.1: DAK1/DegV-like [82549] (3 families) (S)
    domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different
  5. 2921799Family c.119.1.0: automated matches [191443] (1 protein)
    not a true family
  6. 2921800Protein automated matches [190655] (13 species)
    not a true protein
  7. 2921853Species Streptococcus pyogenes [TaxId:160490] [187737] (1 PDB entry)
  8. 2921855Domain d2g7zb1: 2g7z B:1-279 [164596]
    Other proteins in same PDB: d2g7za2, d2g7zb2
    automated match to d1mgpa_
    complexed with cl, gol, hxa, trs, zn

Details for d2g7zb1

PDB Entry: 2g7z (more details), 2.05 Å

PDB Description: Conserved DegV-like Protein of Unknown Function from Streptococcus pyogenes M1 GAS Binds Long-chain Fatty Acids
PDB Compounds: (B:) conserved hypothetical protein SPy1493

SCOPe Domain Sequences for d2g7zb1:

Sequence, based on SEQRES records: (download)

>d2g7zb1 c.119.1.0 (B:1-279) automated matches {Streptococcus pyogenes [TaxId: 160490]}
mgtikivtdssitiepelikalditvvplsvmidsklysdndlkeeghflslmkaskslp
ktsqppvglfaetyenlvkkgvtdivaihlspalsgtieasrqgaeiaeapvtvldsgft
dqamkfqvveaakmakagaslneilaavqaiksktelyigvstlenlvkggrigrvtgvl
ssllnvkvvmalkndelktlvkgrgnktftkwldsylaknshrpiaeiaisyageaslal
tlkeriaayynhsisvletgsiiqthtgegafavmvrye

Sequence, based on observed residues (ATOM records): (download)

>d2g7zb1 c.119.1.0 (B:1-279) automated matches {Streptococcus pyogenes [TaxId: 160490]}
mgtikivtdssitiepelikalditvvplsvmidsklysdndlkeeghflslmkaskslp
ktsqppvglfaetyenlvkkgvtdivaihlspalsgtieasrqgaeiaeapvtvldsgft
dqamkfqvveaakmakagaslneilaavqaiksktelyigvstlenlvkggrigrvtgvn
vkvvmalkndelktlvkgrgnktftkwldsylaknshrpiaeiaisyageaslaltlker
iaayynhsisvletgsiiqthtgegafavmvrye

SCOPe Domain Coordinates for d2g7zb1:

Click to download the PDB-style file with coordinates for d2g7zb1.
(The format of our PDB-style files is described here.)

Timeline for d2g7zb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2g7zb2