SCOPe 2.07: Domain d2g7za1: 2g7z A:1-279

Lineage for d2g7za1 (2g7z A:1-279)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.119: DAK1/DegV-like [82548] (1 superfamily)
   2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest]

4. Superfamily c.119.1: DAK1/DegV-like [82549] (3 families)
   domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different

5. Family c.119.1.0: automated matches [191443] (1 protein)
   not a true family

6. Protein automated matches [190655] (11 species)
   not a true protein

7. Species Streptococcus pyogenes [TaxId:160490] [187737] (1 PDB entry)

8. Domain d2g7za1: 2g7z A:1-279 [164595]
   Other proteins in same PDB: d2g7za2, d2g7zb2
   automated match to d1mgpa_
   complexed with cl, gol, hxa, trs, zn

Details for d2g7za1

PDB Entry: 2g7z, 2.05 Å

PDB Description: Conserved DegV-like Protein of Unknown Function from Streptococcus pyogenes M1 GAS Binds Long-chain Fatty Acids

PDB Compounds: (A:) conserved hypothetical protein SPy1493

SCOPe Domain Sequences for d2g7za1:

Sequence, based on SEQRES records:

>d2g7za1 c.119.1.0 (A:1-279) automated matches {Streptococcus pyogenes [TaxId: 160490]}
mgtikivtdssitiepelikalditvvplsvmidsklysdndlkeeghflslmkaskslp
ktsqppvglfaetyenlvkkgvtdivaihlspalsgtieasrqgaeiaeapvtvldsgft
dqamkfqvveaakmakagaslneilaavqaiksktelyigvstlenlvkggrigrvtgvl
ssllnvkvvmalkndelktlvkgrgnktftkwldsylaknshrpiaeiaisyageaslal
tlkeriaayynhsisvletgsiiqthtgegafavmvrye

Sequence, based on observed residues (ATOM records):

>d2g7za1 c.119.1.0 (A:1-279) automated matches {Streptococcus pyogenes [TaxId: 160490]}
mgtikivtdssitiepelikalditvvplsvmidsklysdndlkeeghflslmkaskslp
ktsqppvglfaetyenlvkkgvtdivaihlspalsgtieasrqgaeiaeapvtvldsgft
dqamkfqvveaakmakagaslneilaavqaiksktelyigvstlenlvkggrigrvtgln
vkvvmalkndelktlvkgrgnktftkwldsylaknshrpiaeiaisyageaslaltlker
iaayynhsisvletgsiiqthtgegafavmvrye

Timeline for d2g7za1:

• d2g7za1 first appeared in SCOPe 2.01, called d2g7za_
  
• d2g7za1 appears in SCOPe 2.06