![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.119: DAK1/DegV-like [82548] (1 superfamily) 2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest] |
![]() | Superfamily c.119.1: DAK1/DegV-like [82549] (3 families) ![]() domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different |
![]() | Family c.119.1.0: automated matches [191443] (1 protein) not a true family |
![]() | Protein automated matches [190655] (13 species) not a true protein |
![]() | Species Streptococcus pyogenes [TaxId:160490] [187737] (1 PDB entry) |
![]() | Domain d2g7za1: 2g7z A:1-279 [164595] Other proteins in same PDB: d2g7za2, d2g7zb2 automated match to d1mgpa_ complexed with cl, gol, hxa, trs, zn |
PDB Entry: 2g7z (more details), 2.05 Å
SCOPe Domain Sequences for d2g7za1:
Sequence, based on SEQRES records: (download)
>d2g7za1 c.119.1.0 (A:1-279) automated matches {Streptococcus pyogenes [TaxId: 160490]} mgtikivtdssitiepelikalditvvplsvmidsklysdndlkeeghflslmkaskslp ktsqppvglfaetyenlvkkgvtdivaihlspalsgtieasrqgaeiaeapvtvldsgft dqamkfqvveaakmakagaslneilaavqaiksktelyigvstlenlvkggrigrvtgvl ssllnvkvvmalkndelktlvkgrgnktftkwldsylaknshrpiaeiaisyageaslal tlkeriaayynhsisvletgsiiqthtgegafavmvrye
>d2g7za1 c.119.1.0 (A:1-279) automated matches {Streptococcus pyogenes [TaxId: 160490]} mgtikivtdssitiepelikalditvvplsvmidsklysdndlkeeghflslmkaskslp ktsqppvglfaetyenlvkkgvtdivaihlspalsgtieasrqgaeiaeapvtvldsgft dqamkfqvveaakmakagaslneilaavqaiksktelyigvstlenlvkggrigrvtgln vkvvmalkndelktlvkgrgnktftkwldsylaknshrpiaeiaisyageaslaltlker iaayynhsisvletgsiiqthtgegafavmvrye
Timeline for d2g7za1: