![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.4: His-Me finger endonucleases [54059] (1 superfamily) core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures |
![]() | Superfamily d.4.1: His-Me finger endonucleases [54060] (8 families) ![]() common motif contains conserved histidine residue and metal-binding site |
![]() | Family d.4.1.6: Endonuclease I [102726] (2 proteins) automatically mapped to Pfam PF04231 |
![]() | Protein automated matches [190330] (3 species) not a true protein |
![]() | Species Vibrio cholerae [TaxId:666] [187736] (3 PDB entries) |
![]() | Domain d2g7fa_: 2g7f A: [164594] automated match to d1ouoa_ complexed with cl, mg |
PDB Entry: 2g7f (more details), 1.95 Å
SCOPe Domain Sequences for d2g7fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g7fa_ d.4.1.6 (A:) automated matches {Vibrio cholerae [TaxId: 666]} sfshakneavkiyrdhpvsfycgceirwqgkkgipdlescgyqvrknenrasriewehvv pawqfghqlqcwqqggrknctrtspefnqmeadlhnltpaigevngnrsnfsfsqwngid gvtygqcemqvnfkertampperargaiartylymseqyglrlskaqnqlmqawnnqypv sewecvrdqkiekvqgnsnrfvreqcpn
Timeline for d2g7fa_: