Lineage for d2g7fa_ (2g7f A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2498207Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
    core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures
  4. 2498208Superfamily d.4.1: His-Me finger endonucleases [54060] (8 families) (S)
    common motif contains conserved histidine residue and metal-binding site
  5. 2498328Family d.4.1.6: Endonuclease I [102726] (2 protein domains)
    automatically mapped to Pfam PF04231
  6. 2498334Protein automated matches [190330] (3 species)
    not a true protein
  7. 2498335Species Vibrio cholerae [TaxId:666] [187736] (3 PDB entries)
  8. 2498337Domain d2g7fa_: 2g7f A: [164594]
    automated match to d1ouoa_
    complexed with cl, mg

Details for d2g7fa_

PDB Entry: 2g7f (more details), 1.95 Å

PDB Description: The 1.95 A crystal structure of Vibrio cholerae extracellular endonuclease I
PDB Compounds: (A:) endonuclease I

SCOPe Domain Sequences for d2g7fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g7fa_ d.4.1.6 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
sfshakneavkiyrdhpvsfycgceirwqgkkgipdlescgyqvrknenrasriewehvv
pawqfghqlqcwqqggrknctrtspefnqmeadlhnltpaigevngnrsnfsfsqwngid
gvtygqcemqvnfkertampperargaiartylymseqyglrlskaqnqlmqawnnqypv
sewecvrdqkiekvqgnsnrfvreqcpn

SCOPe Domain Coordinates for d2g7fa_:

Click to download the PDB-style file with coordinates for d2g7fa_.
(The format of our PDB-style files is described here.)

Timeline for d2g7fa_: