SCOPe 2.05: Domain d2g7ea_: 2g7e A:

Lineage for d2g7ea_ (2g7e A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
   core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures

4. Superfamily d.4.1: His-Me finger endonucleases [54060] (7 families)
   common motif contains conserved histidine residue and metal-binding site

5. Family d.4.1.6: Endonuclease I [102726] (2 proteins)
   automatically mapped to Pfam PF04231

6. Protein automated matches [190330] (3 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:666] [187736] (3 PDB entries)

8. Domain d2g7ea_: 2g7e A: [164593]
   automated match to d1ouoa_
   complexed with cl

Details for d2g7ea_

PDB Entry: 2g7e, 1.6 Å

PDB Description: The 1.6 A crystal structure of Vibrio cholerae extracellular endonuclease I

PDB Compounds: (A:) endonuclease I

SCOPe Domain Sequences for d2g7ea_:

Sequence; same for both SEQRES and ATOM records:

>d2g7ea_ d.4.1.6 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
fshakneavkiyrdhpvsfycgceirwqgkkgipdlescgyqvrknenrasriewehvvp
awqfghqlqcwqqggrknctrtspefnqmeadlhnltpaigevngnrsnfsfsqwngidg
vtygqcemqvnfkertampperargaiartylymseqyglrlskaqnqlmqawnnqypvs
ewecvrdqkiekvqgnsnrfvreqcpn

Timeline for d2g7ea_:

• d2g7ea_ first appeared in SCOPe 2.01
  
• d2g7ea_ appears in SCOPe 2.04
  
• d2g7ea_ appears in SCOPe 2.06
  
• d2g7ea_ appears in the current release, SCOPe 2.08