SCOPe 2.06: Domain d2g78a_: 2g78 A:

Lineage for d2g78a_ (2g78 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Cellular retinoic-acid-binding protein (CRABP) [50861] (2 species)

7. Species Human (Homo sapiens), CRABP-II [TaxId:9606] [50862] (52 PDB entries)

8. Domain d2g78a_: 2g78 A: [164590]
   automated match to d1blra_
   complexed with na, rea; mutant

Details for d2g78a_

PDB Entry: 2g78, 1.7 Å

PDB Description: crystal structure of the r132k:y134f mutant of cellular retinoic acid binding protein type ii in complex with all-trans-retinoic acid at 1.70 angstroms resolution

PDB Compounds: (A:) Cellular retinoic acid-binding protein 2

SCOPe Domain Sequences for d2g78a_:

Sequence; same for both SEQRES and ATOM records:

>d2g78a_ b.60.1.2 (A:) Cellular retinoic-acid-binding protein (CRABP) {Human (Homo sapiens), CRABP-II [TaxId: 9606]}
pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvrt
teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtreltndgeli
ltmtaddvvctkvfvre

Timeline for d2g78a_:

• d2g78a_ first appeared in SCOPe 2.01
  
• d2g78a_ appears in SCOPe 2.05
  
• d2g78a_ appears in SCOPe 2.07
  
• d2g78a_ appears in the current release, SCOPe 2.08