Lineage for d1hioc_ (1hio C:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 46311Fold a.22: Histone-fold [47112] (1 superfamily)
  4. 46312Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 46313Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
  6. 46341Protein Histone H3 [47122] (2 species)
  7. 46347Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47123] (4 PDB entries)
  8. 46353Domain d1hioc_: 1hio C: [16459]
    Other proteins in same PDB: d1hioa_, d1hiob_, d1hiod_

Details for d1hioc_

PDB Entry: 1hio (more details), 3.1 Å

PDB Description: histone octamer (chicken), chromosomal protein, alpha carbons only

SCOP Domain Sequences for d1hioc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hioc_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes}
pgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvg
lfedtnlcaihakrvtimpkdielarrirgera

SCOP Domain Coordinates for d1hioc_:

Click to download the PDB-style file with coordinates for d1hioc_.
(The format of our PDB-style files is described here.)

Timeline for d1hioc_: